PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna11416.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HRT-like
Protein Properties Length: 480aa    MW: 53675.5 Da    PI: 9.7664
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna11416.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like57.22.7e-18298328131
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                              +CGv+ +dG+ C++ Pv+gRKRC+eHKGmRi
  mrna11416.1-v1.0-hybrid 298 VCGVAVGDGTLCRKAPVQGRKRCAEHKGMRI 328
                              7*****************************7 PP

2HRT-like603.7e-19363393131
                 HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                              iCGv+ +dGs+C+++Pv+gRKRC+eHKGmRi
  mrna11416.1-v1.0-hybrid 363 ICGVAVGDGSICRTPPVHGRKRCAEHKGMRI 393
                              8*****************************7 PP

3HRT-like24.16.2e-08442462121
                 HRT-like   1 iCGviledGsvCkrqPvkgRK 21 
                              iCG+il dGs+C+++P++ +K
  mrna11416.1-v1.0-hybrid 442 ICGFILADGSPCRTEPIQRKK 462
                              8*****************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MVASDFTALL PRLKREECKR TKHDSHFSNW KVLVGPSDWE DYWLGKEGAE RYRVYNLPRD  60
ESPGVYELGV AVSRSGLGRG VEADRIVPVY LGQADSVRTR LQQYGRTGAH LGKCCSSERI  120
RKGPGLFEEM LGRGYPIVYR WAPHGCICIF ILILIRMRAR MLEIHPGECC ACHYEISQFM  180
ETKSNALKTE SQLLNTFDYA WNTSINGARR PDDVLQRLKK ISSKPTRFTN IVQRLLPFSQ  240
KQVGIRINSS KLVSKEEKFS GYADRENLNL IAQVFKFGRS QPRLVVDRSG ISQENTIVCG  300
VAVGDGTLCR KAPVQGRKRC AEHKGMRITV KISNSNIGSK CSVISNREFV SDESGITQEN  360
TIICGVAVGD GSICRTPPVH GRKRCAEHKG MRIKESITVR VSEKYVDSKF SNKELDSHDA  420
SNVKYEQVKL PPVHVCESST SICGFILADG SPCRTEPIQR KKGVISTKGE GSRNPTQRQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288924.20.0PREDICTED: uncharacterized protein LOC101314891 isoform X2
RefseqXP_011459779.10.0PREDICTED: uncharacterized protein LOC101314891 isoform X1
TrEMBLM5VTH71e-163M5VTH7_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF94093139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-84effector of transcription2